Trademark details
- Jurisdiction
-
Italy
- Registration number
- 302020000061309
- Mark type
- English
- Trademark classes
- 03
- Legal status
- R
- Domain included
- No / not confirmed
- Platform listing ID
- TM-LG-5008919
- Registration date
- 2021-01-21
- Renewal due date
- 2031-01-21
- Registry check
- Not provided
- Ownership verification
- Not provided
- Domain name
- Not provided
- Next maintenance deadline
- Not provided. Confirm applicable maintenance deadlines before purchase.
Goods & services
Soap*;Lipstickbeautyfacialmaskskinwhiteningcream;Falseeyelashes;Substitutesforcosmetics;Cottonwoolforcosmeticsandmakeup;Detergent;Essentialoils;Spiceoil;Toiletpreparation*;Shampoo*;Perfume;Cosmeticsandskincareproducts;Breathfreshenerspray;Petdeodorant;Cottonthreadsoakedinmakeupremover;Cosmeticcottonswabs;NonmedicalMouthwash
Category descriptions are summaries. Confirm the registered wording before purchase.
Verification & supporting documents
Confirm the following documents and transfer requirements with a qualified professional before purchase.
- Official registry extract and current legal status.
- Ownership verification, authority to sell and complete chain of title.
- Evidence of use, licenses, security interests and disputes.
- Goods and services, transfer restrictions and included goodwill.
- Any domain or additional assets expressly included in the contract.
Purchase and transfer
Ownership, availability and the transfer agreement must be checked. Your purchase is not complete until the agreed transfer conditions are met.
Choose 20% upfront or full payment. The remaining balance is due after you approve the transfer agreement and before the agreed transfer step.
Switzerland
United States
